The domain within your query sequence starts at position 1495 and ends at position 1602; the E-value for the DUF3496 domain shown below is 1.3e-47.
RSQMELRIKDLESQLYRMKAQEDFDKIELEKYKQLYQEEFRARKSLSSKLNKTSEKLEEA SSKLLLEEQQNRSLLSTLSTRPVVECPCVGSFHNSLVFNRTLIPRENI
DUF3496 |
 |
|---|
| PFAM accession number: | PF12001 |
|---|---|
| Interpro abstract (IPR021885): | This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is about 110 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3496