The domain within your query sequence starts at position 317 and ends at position 594; the E-value for the DUF3498 domain shown below is 2.9e-78.
LSGSSGVQPSPARSSSYSEANEPDLQMANGSKSLSMVDLQDARTLDGEAGSPVGPDALPA DGQVPATQLLAGWPARAAPVSLAGLATVRRAVPTPTTPGTSEGAPGRPQLLAPLSFQNPV YQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARR QMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGT LASASPDWAGPGTRLRQQSSSSKGDSPELKPRAMHKQD
DUF3498 |
---|
PFAM accession number: | PF12004 |
---|---|
Interpro abstract (IPR021887): | This presumed domain can be found at the C terminus of Ras GTPase-activating proteins (RasGAPs). This domain is typically between 433 to 538 amino acids in length. It is found associated with the RasGAP domain ( IPR001936 ) and the C2 domain ( IPR000008 ). This domain has two conserved sequence motifs: DLQ and PLSFQNP. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3498