The domain within your query sequence starts at position 565 and ends at position 692; the E-value for the DUF3510 domain shown below is 6.1e-45.
QDLSESCFSYLKSALEVPRLYRRTNKEVPSTASSYVDSALKPLYQLQSGHGDKVQPAVMQ SWLQEALSDSTHRYFETVSDVLNSVKKMEESLKRLKQARRSPATNPVSSSGGGMSDDDKI RLQLALDV
DUF3510 |
![]() |
---|
PFAM accession number: | PF12022 |
---|---|
Interpro abstract (IPR024603): | The COG complex comprises eight proteins (COG1-8) and plays critical roles in Golgi structure and function [ (PUBMED:11980916) ]. This uncharacterised domain is found in the C-terminal of COG complex subunit 2 proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3510