The domain within your query sequence starts at position 20 and ends at position 193; the E-value for the DUF3523 domain shown below is 5e-50.
PLPPAQPGAEGGGDRGAGDRPSPKDKWSNFDPTGLERAAKAARELEHSRHAKEALSLAQM QEQTLQLEQQSKLKEYEAAVEQLKSEQIRVQAEERRKTLTEETRQHQARAQYQDKLARQR YEDQLKQQQLLNEENLRKQEESVQKQEAIRRVSRSMCACQQCGQRQVQCGLKTT
DUF3523 |
![]() |
---|
PFAM accession number: | PF12037 |
---|---|
Interpro abstract (IPR021911): | This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 257 to 277 amino acids in length. This domain is found associated with . This domain has a conserved LER sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3523