The domain within your query sequence starts at position 103 and ends at position 198; the E-value for the DUF3528 domain shown below is 7.1e-21.
PYYAAAAAAAAAAAAAEEAAMQRDLLPPAGRRPDVLFKAPEPVCGAPGPPHGPAAAASNF YSAVGRNGILPQGFDQFYEAAPGPPFAGPQPQPAPA
DUF3528 |
 |
|---|
| PFAM accession number: | PF12045 |
|---|---|
| Interpro abstract (IPR021918): | This domain of unknown function is found at the N terminus of some Homeobox proteins belonging to the ABD-B family. It is found in association with . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3528