The domain within your query sequence starts at position 838 and ends at position 1048; the E-value for the DUF3543 domain shown below is 1.8e-26.
EQEHTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWGF AEQLVLYLKVAELLSSGLQTAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLR LQRFFLDKQRLLDGIHGVTAERLILSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEG LQHTLTDQADIENIAKCKLCIERRLSALLSG
DUF3543 |
![]() |
---|
PFAM accession number: | PF12063 |
---|---|
Interpro abstract (IPR022708): | This domain belonging to serine/threonine-protein kinases is functionally uncharacterised. This domain is found in eukaryotes. It is typically between 217 to 291 amino acids in length and is found associated with . This domain has a single completely conserved residue A that may be functionally important. |
GO function: | protein serine/threonine kinase activity (GO:0004674) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3543