The domain within your query sequence starts at position 387 and ends at position 460; the E-value for the DUF3544 domain shown below is 3.1e-29.
SKPLLSGGAGRRISLSDMPRSPTSTNSSVHTGSDVEQDPEKKAPSSHFSASEESMDFLDK STGQPQLGELGRRP
DUF3544 |
---|
PFAM accession number: | PF12064 |
---|---|
Interpro abstract (IPR021931): | Protein kinase C-binding protein 1 (also known as ZMYND8) acts as a transcriptional corepressor of the H3K4 demethylase JARID1D [ (PUBMED:27477906) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3544