The domain within your query sequence starts at position 586 and ends at position 710; the E-value for the DUF3591 domain shown below is 1.5e-28.
WNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYS FGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYS EENGP
DUF3591 |
---|
PFAM accession number: | PF12157 |
---|---|
Interpro abstract (IPR022591): | This functionally uncharacterised domain is found centrally in the eukaryotic transcription initiation factor TFIID subunit 1. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3591