The domain within your query sequence starts at position 9 and ends at position 124; the E-value for the DUF3631 domain shown below is 9.4e-10.

PLRKHLEAVQKMKAKEERRVTELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMH
EAQLGRAGAAANRLEEQAAQLSRLLAEAQERSQQGGLRLLQDIKETFNRCVPTLPF

DUF3631

DUF3631
PFAM accession number:PF12307
Interpro abstract (IPR022081):

This domain is found in uncharacterised proteins and in tripartite motif containing (TRIM) protein 41. This protein functions as an E3 ligase that catalyzes the ubiquitin-mediated degradation of protein kinase C [ (PUBMED:17893151) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3631