The domain within your query sequence starts at position 111 and ends at position 172; the E-value for the DUF3657 domain shown below is 1.9e-19.
LKVDLHFTDSEQQLRDVTGTPMISSRTLGLHFHPRRGLHHQVPVMFDYFHLSVISVAIHA AL
DUF3657 |
---|
PFAM accession number: | PF12394 |
---|---|
Interpro abstract (IPR022122): | This family is found in eukaryotes, and is approximately 60 amino acids in length. Proteins in this family contain a domain found in a group of putative lipases ( IPR007751 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3657