The domain within your query sequence starts at position 231 and ends at position 298; the E-value for the DUF3669 domain shown below is 4.7e-12.
VWAAVQAVERKLEAQAMRLLTLEGRTGTNEKKIADCERTAVEFANHLESKWVVLGTLLQE YGLLQRRL
DUF3669 |
![]() |
---|
PFAM accession number: | PF12417 |
---|---|
Interpro abstract (IPR022137): | This domain family is found in eukaryotes, and is typically between 64 and 80 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3669