The domain within your query sequence starts at position 1148 and ends at position 1304; the E-value for the DUF3694 domain shown below is 5e-40.
DYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHETGSHIRWKEVRELVVGRIRNTPET DEALIDPNILSLNILSSGYVHPAQDDRQFLDSDIPRTFYQFEAAWDSSMHNSLLLNRVTP YREKIYMTLSAYIEMENCTQPAVITKDFCMVFYSRDA
DUF3694 |
![]() |
---|
PFAM accession number: | PF12473 |
---|---|
Interpro abstract (IPR022164): | This domain is found in eukaryotes, and is typically between 131 and 151 amino acids in length. There is a single completely conserved residue W that may be functionally important. It is found in some kinesin-like proteins and in Rab GTPase-activating protein 1. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3694