The domain within your query sequence starts at position 91 and ends at position 167; the E-value for the DUF3699 domain shown below is 1.4e-24.
DLYEVELTNKQGENIDKLMEYVKNKELALIKCLEDKSFFILFTSSALTPEPGFGAEQMGL HGLHLFHAPQTAGAKDL
DUF3699 |
---|
PFAM accession number: | PF12480 |
---|---|
Interpro abstract (IPR022168): | This domain family is found in eukaryotes, and is approximately 80 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3699