The domain within your query sequence starts at position 66 and ends at position 158; the E-value for the DUF3700 domain shown below is 5.7e-9.
KYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFIL LDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVC
DUF3700 |
![]() |
---|
PFAM accession number: | PF12481 |
---|---|
Interpro abstract (IPR024286): | This entry represents a domain found in plant proteins that is approximately 120 amino acids in length. There are two conserved sequence motifs: YGL and LRDR. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3700