The domain within your query sequence starts at position 533 and ends at position 679; the E-value for the DUF3740 domain shown below is 1.1e-48.
YKPRFVHTRQTRSLSVEFEGEIYDINLEEEELQVLPPRSIAKRHDEGHQGFIGHQAAAGD IRNEMLADSNNAVGLPATVRVTHKCFILPNDTIHCERELYQSARAWKDHKAYIDKEIEVL QDKIKNLREVRGHLKKRKPEECGCGDQ
DUF3740 |
---|
PFAM accession number: | PF12548 |
---|---|
Interpro abstract (IPR024609): | This uncharacterised domain is found in the C-terminal region of extracellular sulphatase proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3740