The domain within your query sequence starts at position 210 and ends at position 319; the E-value for the DUF3776 domain shown below is 1.3e-31.
KLPSKKAETSTCIVTAEIEKKEELPTSSETFVGLHIDTVPKIVFPQPESTLTNKRKNNQG NSFQAKRARLNKITGLLASKAVGVDGAERKEDCSATAPVLEQAISPKPQS
DUF3776 |
![]() |
---|
PFAM accession number: | PF12618 |
---|---|
Interpro abstract (IPR022255): | This domain is found in eukaryotes, and is approximately 100 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3776