The domain within your query sequence starts at position 453 and ends at position 579; the E-value for the DUF382 domain shown below is 2.9e-63.
ARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIK RTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGD LYYEGKE
DUF382 |
![]() |
---|
PFAM accession number: | PF04037 |
---|---|
Interpro abstract (IPR007180): | This domain is specific to the human splicing factor 3b subunit 2 and its orthologs. |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF382