The domain within your query sequence starts at position 11 and ends at position 80; the E-value for the DUF3915 domain shown below is 3.1e-10.
SYTHTHTHTHTHTHTHTHTQRERERERERERERERERERKSNTRVMVNHYHTVLQSTLLL ISYLRMLASL
DUF3915 |
 |
|---|
| PFAM accession number: | PF13054 |
|---|---|
| Interpro abstract (IPR025026): | This family of proteins is functionally uncharacterised. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3915