The domain within your query sequence starts at position 42 and ends at position 145; the E-value for the DUF4062 domain shown below is 1.5e-8.
RVFISANPEDTGAERQALRETVYPKLREFCRENYGLEFQVIDLYWGIEEDEWDSPELQKM RMKLLEECLKTSAGPCFVGLLGEKYGNIRIPGEVEASEFEMILD
DUF4062 |
---|
PFAM accession number: | PF13271 |
---|---|
Interpro abstract (IPR025139): | This presumed domain is functionally uncharacterised. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 80 amino acids in length. There is a conserved SST sequence motif. This domain can be found in telomerase protein component 1 (TEP1), which is a component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini [ (PUBMED:19179534) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4062