SMART: Pfam domain DUF4062

The domain within your query sequence starts at position 42 and ends at position 145; the E-value for the DUF4062 domain shown below is 1.5e-8.

RVFISANPEDTGAERQALRETVYPKLREFCRENYGLEFQVIDLYWGIEEDEWDSPELQKM
RMKLLEECLKTSAGPCFVGLLGEKYGNIRIPGEVEASEFEMILD

DUF4062

PFAM accession number:	PF13271
Interpro abstract (IPR025139):	This presumed domain is functionally uncharacterised. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 80 amino acids in length. There is a conserved SST sequence motif. This domain can be found in telomerase protein component 1 (TEP1), which is a component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini [ (PUBMED:19179534) ].

PFAM accession number:

PF13271

Interpro abstract (IPR025139):

This presumed domain is functionally uncharacterised. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 80 amino acids in length. There is a conserved SST sequence motif.

This domain can be found in telomerase protein component 1 (TEP1), which is a component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini [ (PUBMED:19179534) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4062