The domain within your query sequence starts at position 909 and ends at position 1020; the E-value for the DUF4062 domain shown below is 2.4e-22.

RLFISSTFRDMHGERDLLMRSVLPALQARVFPHRISLHAIDLRWGITEEETRRNRQLEVC
LGEVENSQLFVGILGSRYGYIPPSYDLPDHPHFHWTHEYPSGRSVTEMEVMQ

DUF4062

DUF4062
PFAM accession number:PF13271
Interpro abstract (IPR025139):

This presumed domain is functionally uncharacterised. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 80 amino acids in length. There is a conserved SST sequence motif.

This domain can be found in telomerase protein component 1 (TEP1), which is a component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini [ (PUBMED:19179534) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4062