The domain within your query sequence starts at position 377 and ends at position 441; the E-value for the DUF4074 domain shown below is 9e-32.
SNSGPLFGLTHLPHTTSAAMDYGGTGPLGSGHHHGPGPGEPHPTYTDLTAHHPSQGRIQE APKLT
DUF4074 |
---|
PFAM accession number: | PF13293 |
---|---|
Interpro abstract (IPR025281): | This functionally uncharacterised domain is found at the C-terminal of a number of metazoan homeobox proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4074