The domain within your query sequence starts at position 56 and ends at position 306; the E-value for the DUF410 domain shown below is 4.6e-79.
QSKHAEARELMYSGALLFFSHGQQNSAADLSMLVLESLEKAEVDVADELLENLAKVFSLM DPNSPERVAFVSRALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHFLHSSDGEGC ANMLVEYSTARGFRSEVDMFVAQAVLQFLCLKNKNSALVVFTTYTQKHPSIEDGPPFVQP LLNFIWFLLLAVDGGKLAVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYG GLLGNLLSSLM
DUF410 |
---|
PFAM accession number: | PF04190 |
---|---|
Interpro abstract (IPR007317): | In budding yeast, Get4 is part of the GET complex that inserts the tail-anchored (TA) proteins into the endoplasmic reticulum membrane [ (PUBMED:22190685) (PUBMED:24727835) ]. In humans, Get4 is part the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and facilitates their proper delivery to the endoplasmic reticulum, or alternatively promotes their sorting to the proteasome where they undergo degradation [ (PUBMED:20676083) (PUBMED:21636303) (PUBMED:21743475) (PUBMED:28104892) ]. The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane [ (PUBMED:20676083) (PUBMED:28104892) (PUBMED:25535373) ]. |
GO process: | protein insertion into ER membrane (GO:0045048) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF410