The domain within your query sequence starts at position 17 and ends at position 119; the E-value for the DUF4149 domain shown below is 2.3e-26.
LVLSGAWGMQVWVTFISGFLLFRSLPRHTFGLVQSKVFPVYFHVSLGCAFINLCILAPQR AWIHLTLWEVSQLSLLLLSLTLATINARWLEARTTAVMRALQS
DUF4149 |
---|
PFAM accession number: | PF13664 |
---|---|
Interpro abstract (IPR025423): | This presumed domain is functionally uncharacterised. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4149