The domain within your query sequence starts at position 178 and ends at position 354; the E-value for the DUF4201 domain shown below is 6.2e-52.
MNRRRDNIKDKLCLKNVSLKVQRKKMLSQLRQKEEVGEALHDVDFQQLKIENAQFLETIE ARNKELIQLKLASGNTLQVLNTYKNKLHRAMEIYVNLDKEILLRNELLGKIEKETIQAEE DRAKAHILNDKLRKQLAEFRAPQVMMYVKEKILNGELEKTIKMWERKVEIAEMSLKG
DUF4201 |
---|
PFAM accession number: | PF13870 |
---|---|
Interpro abstract (IPR025254): | This is a family of coiled-coil proteins from eukaryotes. Their function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4201