The domain within your query sequence starts at position 25 and ends at position 174; the E-value for the DUF4207 domain shown below is 6.3e-24.
SNSTLSLLSPLGHQSFPFGADDSEGEDEEALDEDARESESKVESLEGIEFQQRSSCEVES QDKQEKLVLLQHGSLTPWEMWFVGKEKEERGRLQQKFLEELNQQIEKRKEMEEREKRKII AEVKHKEWVQKKNKQKVPYVQLHSAPCSLR
DUF4207 |
---|
PFAM accession number: | PF13904 |
---|---|
Interpro abstract (IPR025259): | This uncharacterised family contains several conserved tryptophan residues. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4207