The domain within your query sequence starts at position 133 and ends at position 214; the E-value for the DUF4209 domain shown below is 3.1e-27.
LERALGDVFLLVGKECPFLLRDLLASAELAQVFGHAVMDILKVFIGSPCGLNLRNVLWHG FASPQDIPPKYCSAMLLLTAGL
DUF4209 |
 |
|---|
| PFAM accession number: | PF13910 |
|---|---|
| Interpro abstract (IPR025209): | This short domain is functionally uncharacterised. It carries a highly conserved RNxxxHG sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4209