The domain within your query sequence starts at position 281 and ends at position 412; the E-value for the DUF4371 domain shown below is 1.6e-10.
AKDRVRVMIGDEFVTKLSAVSLSNDTVRRRIHDMSADILDQVVQEIKSAPLPICSIQLDE STDVANCLQLMVYVRYINDGDFKDEFLCCKPLERTATALDVFEAVDSFLRQHEISWKSIC GVCTDGAPATLG
DUF4371 |
![]() |
---|
PFAM accession number: | PF14291 |
---|---|
Interpro abstract (IPR025398): | This is a conserved domain found in deubiquitinating enzymes, MINDY-3 and MINDY-4. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4371