The domain within your query sequence starts at position 355 and ends at position 426; the E-value for the DUF4430 domain shown below is 7.9e-11.
GSSLEDVLKLAQDGGGFTYGTQASLSGPYLTSVLGKDAGDREYWQLLRAPDTPLLQGIAD YKPQDGETIELR
DUF4430 |
![]() |
---|
PFAM accession number: | PF14478 |
---|---|
Interpro abstract (IPR027954): | This domain of unknown function is found at the -terminus of transcobalamin, a vitamin B12-binding protein that transports cobalamin (vitamin B12) into cells [ (PUBMED:2777761) ]. This domain is also found in several uncharacterised proteins, like A0RGA8 that have an LPXTG-cell wall anchor at their C terminus, a polysaccharide lyase or glycosyltransferase structure associated with them in the middle region, as well as this domain at the N terminus. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4430