The domain within your query sequence starts at position 733 and ends at position 863; the E-value for the DUF4457 domain shown below is 2.6e-31.
GEPVQISSITADPPDINILPAYGKDPRVVSNLIDGVNRTQDDMHVWLAPFTPGMTHTISI EFTHPCQVALIRIWNYNKSRIHSFRGVKDITMLLDTQCIFEGEIAKASGTLMGAPEHFGD TILFTMDEDIL
DUF4457 |
---|
PFAM accession number: | PF14652 |
---|---|
Interpro abstract (IPR027859): | This domain can found in eukaryotic proteins such as KATNIP. It repeats several times in the vertebrate KATNIP. KATNIP is a microtubule-associated ciliary base protein probably involved in microtubule regulation [ (PUBMED:26714646) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4457