The domain within your query sequence starts at position 944 and ends at position 1008; the E-value for the DUF4457 domain shown below is 5.9e-21.

RLNLTASWGDLHYIGLTGLEVVGKDGEALPIQPHQLSASPRDLNDLPEYNDDSRTLDKCP
FTVAL

DUF4457

DUF4457
PFAM accession number:PF14652
Interpro abstract (IPR027859):

This domain can found in eukaryotic proteins such as KATNIP. It repeats several times in the vertebrate KATNIP.

KATNIP is a microtubule-associated ciliary base protein probably involved in microtubule regulation [ (PUBMED:26714646) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4457