The domain within your query sequence starts at position 30 and ends at position 121; the E-value for the DUF4476 domain shown below is 4e-27.
HGYFSSEQVVDLLRYFSWAEPQLKAMKALQHKMVAVHPAEVVSILSCFTFSKDKLAALEL LASNIVDAQNSRPIEDLFRINMSEKKRCKRVL
DUF4476 |
---|
PFAM accession number: | PF14771 |
---|---|
Interpro abstract (IPR028011): | This domain is functionally uncharacterised. It is found in eukaryotic and bacterial sequences. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4476