The domain within your query sequence starts at position 909 and ends at position 1042; the E-value for the DUF4482 domain shown below is 4e-49.
MDLRWQIHHREKNWNREKVELLERLDSERQEWGRQKEELLWRVEQLQKEKSPRRSGSFLC SRREDDTRPYPHQGSLHSSRPVSMWPCEDADSIPFEDRPLSKLKESDRCSASENLYLDAL SLDDDPGDPPPLRN
DUF4482 |
![]() |
---|
PFAM accession number: | PF14818 |
---|---|
Interpro abstract (IPR027882): | This uncharacterised domain is found in proteins from eukaryotes, including the members of the SOGA (suppressor of glucose by autophagy) family. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4482