The domain within your query sequence starts at position 12 and ends at position 99; the E-value for the DUF4485 domain shown below is 5.4e-31.
KLDAEFDHFVVDMKPFVLKLPHRSERQRCALWIRKLCEPSGTGAGLMGRKNRNLYAKLLL HMLRRGILEGPFTHRPEPGTLKTLPSYM
DUF4485 |
---|
PFAM accession number: | PF14846 |
---|---|
Interpro abstract (IPR027831): | This domain of unknown function is found in eukaryotic proteins, and is approximately 90 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4485