The domain within your query sequence starts at position 103 and ends at position 148; the E-value for the DUF4486 domain shown below is 4.3e-22.
QKYEFHRRCATTLFNIWTKYAPRLPSNYYNEKLLKVGDSLCQIKFH
DUF4486 |
![]() |
---|
PFAM accession number: | PF14858 |
---|---|
Interpro abstract (IPR027912): | CFAP54 is required for assembly and function of cilia and flagella [ (PUBMED:26224312) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4486