The domain within your query sequence starts at position 31 and ends at position 209; the E-value for the DUF4505 domain shown below is 5.4e-84.
SYTQGQSPEPRTREYFYYVDHQGQLFLDDSKMKNFITCFKDLQFLVTFFSRLRPNHSGRY EASFPFLSLCGRERNFLRCEDRPVVFTHLLASDSESPRLSYCGGGEALAIPFEPARLLPL AANGRLYHPAPERAGGVGLVRSALAFELSACFEYGPSSPTVPSHVHWQGRRIALTMDLA
DUF4505 |
---|
PFAM accession number: | PF14956 |
---|---|
Interpro abstract (IPR028108): | This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 166 and 225 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4505