The domain within your query sequence starts at position 258 and ends at position 418; the E-value for the DUF4510 domain shown below is 3.1e-73.
CSPETPAVTSQPTFLPEISEGGLGELESVKQELQALQEELREVSEPRRAAWEARVGGLGQ GPEWSNSRKALQEAVQQELAALQGSWEQSSTPGQPQRPHRLVRSKDGAPRPQGLQAAEVI RTLSAKEACLKKALHQLQRQCQQELARLAGALPGLIWILPP
DUF4510 |
---|
PFAM accession number: | PF14971 |
---|---|
Interpro abstract (IPR028100): | This domain is found in eukaryotes and contains two conserved sequence motifs: LEA and WMD. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4510