The domain within your query sequence starts at position 3 and ends at position 140; the E-value for the DUF4513 domain shown below is 9.3e-75.
SEKDDGPALPKLDDDNQTAENTCKPAEEQPQQLRWDDIHLPRFSLKQGMIPTRYVMPWKE NMKFRNVNLQQAEACGIYAGPLEDSLFWGYSERLCHGEDRKAVLKKGLPEIKITDMPLHS PLSRYQSTVISHGFRRRL
DUF4513 |
![]() |
---|
PFAM accession number: | PF14983 |
---|---|
Interpro abstract (IPR027965): | This family of uncharacterised proteins is found in metazoans. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4513