The domain within your query sequence starts at position 16 and ends at position 75; the E-value for the DUF4514 domain shown below is 3.6e-40.
GIGGAQVLATGKPAETEIDFKYAIIGMAVGVAISAGFLALKICMIRRHLSDNDSADLKNT
DUF4514 |
---|
PFAM accession number: | PF14986 |
---|---|
Interpro abstract (IPR029395): | This family of uncharacterised proteins are found in mammals, including TMEM273 from humans. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4514