The domain within your query sequence starts at position 77 and ends at position 282; the E-value for the DUF4515 domain shown below is 5.6e-82.
ENQLFMEYLRKNKEQCEKKQEELWKQYVQECGEIERERQELASRYNQRNAALQAQLLQGR KTQKDLKQQLQALKPVYKIKEGQDVKIQTLEKEQEKVRSETATKDREAHFQFLREKALME KELQEWHLMELGQINTTGLTRKYKALALAAKQAHSEFCGSLHRENQQLRKELQQLSQEYG RLDAVRSQLEKHRQLAKEQQWYLEAL
DUF4515 |
![]() |
---|
PFAM accession number: | PF14988 |
---|---|
Interpro abstract (IPR032777): | This domain contains two completely conserved L residues that may be functionally important. Proteins with this domain include basal body-orientation factor 1 (bbof1), and coiled-coil domain-containing protein 166 and 121. Bbof1 is required to maintain cilia orientation [ (PUBMED:23900544) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4515