The domain within your query sequence starts at position 2 and ends at position 138; the E-value for the DUF4525 domain shown below is 3.4e-70.
AFFSPWKLSSQKLGFFLVTFGFIWGMMLLHFTIQQRTQPESSSMLREQILDLSKRYIKAL AEENRDVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNLVNGTGANSTNSTTA VPSLVSLEKINVADIIN
DUF4525 |
![]() |
---|
PFAM accession number: | PF15027 |
---|---|
Interpro abstract (IPR027833): | This domain is found in eukaryotes. It is often found at the N terminus of glycosyltransferase family 18 enzymes. It is also found in coiled-coil domain-containing protein 126. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4525