The domain within your query sequence starts at position 3 and ends at position 165; the E-value for the DUF4534 domain shown below is 9.7e-70.
SRMISITVGIFSMLNTIQFFIFELNQMTHIGFEDKYSIYLDTESDVASWVVVYRHNISTG LSIATIMVSCFFLFCLDKNMFIGLLIYTVWITVYELLSFIMVLLIHGTIKEQFKELGYLY LLLQISRMLLHFAALPFVVKHGYTLYRDPKIMSLAGRRKRSSI
DUF4534 |
---|
PFAM accession number: | PF15049 |
---|---|
Interpro abstract (IPR027862): | This family of functionally uncharacterised proteins is found in mammals. It includes human transmembrane TMEM217 protein. Proteins in this family are typically between 170 and 190 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4534