The domain within your query sequence starts at position 24 and ends at position 77; the E-value for the DUF4537 domain shown below is 8.3e-12.

TGWLLLSGSDKGCSRASKEKEITVHFWNGKTTKVPLGSVRWVPPTVWKKAVERL

DUF4537

 DUF4537
PFAM accession number:PF15057
Interpro abstract (IPR032770):

The function of this domain is unknown. It is found in eukaryotes, and is typically between 119 and 141 amino acids in length. In humans, it is found in the chromosomal position C11orf16.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4537