The domain within your query sequence starts at position 458 and ends at position 541; the E-value for the DUF4539 domain shown below is 4.4e-33.
NKVPNMAVMIKSLTRSTMDASVVFKDPTGEMLGTVHRVLLETHQSELRPGSVLLLKQIGV FSPSLRNHYLNVTPNNLVHIYSLD
DUF4539 |
![]() |
---|
PFAM accession number: | PF15072 |
---|---|
Interpro abstract (IPR028045): | During homologous recombination, HROB acts by recruiting the MCM8-MCM9 helicase complex to sites of DNA damage to promote DNA repair synthesis [ (PUBMED:31467087) (PUBMED:31575675) ]. |
GO process: | recombinational repair (GO:0000725) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4539