The domain within your query sequence starts at position 1 and ends at position 65; the E-value for the DUF4543 domain shown below is 6.9e-45.
EKQAKQLLRSRRQDRPNKPGFPDEPMREYMHHLLALEHRAEEQFLEHWLNPHCKPHCDRN IVHPV
DUF4543 |
 |
|---|
| PFAM accession number: | PF15076 |
|---|---|
| Interpro abstract (IPR027870): | This family of proteins is found in eukaryotes. The human member of this family is C17orf67. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4543