The domain within your query sequence starts at position 19 and ends at position 214; the E-value for the DUF4547 domain shown below is 5e-120.
DNKLRALDTQFKELDVTKDNLTLRFEHHSKTLASQAAQDEIWTAALALGFTSMELNIVYS YVIEVLICLHTRMLQKLPDLVRSLPTLASVLRRKAKNKHVRLVWESVLQEYGLQERDVSA LCTFFIVHGNKGEHYAANVRRMYIKDVSFMITNMVKNQALQDGLLRAVQIIEKGKQAQDP ENSRAPLKELMPPVKD
DUF4547 |
---|
PFAM accession number: | PF15080 |
---|---|
Interpro abstract (IPR027875): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 144 and 206 amino acids in length. The human member of this family is C3orf43, also annotated as single-pass membrane and coiled-coil domain-containing protein 1. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4547