The domain within your query sequence starts at position 2 and ends at position 145; the E-value for the DUF4549 domain shown below is 7.9e-74.
DSVYKFSSTERIVLLEKELAVKLSELKTEVEDQGLFPGTGNRIFSSVQIPKDVAHFRRER EAALKRTLQVAESKPLVIQADVLKRELESCLRREYTPENLPLLLLQYYTERITQLGQSKY LHVLRWKRLCQTSMAMEELYPLYK
DUF4549 |
![]() |
---|
PFAM accession number: | PF15082 |
---|---|
Interpro abstract (IPR029376): | This entry represents a domain found in eukaryotic proteins that are typically between 143 and 1871 amino acids in length. The human member of this group is C6orf183. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4549