The domain within your query sequence starts at position 4 and ends at position 67; the E-value for the DUF4560 domain shown below is 1.5e-42.
ADAPSALALRAVGPAAATPYGVFCKGLSRTLLAFFELAWQLRMNFPYFYIAGSVILNIRL QVHI
DUF4560 |
---|
PFAM accession number: | PF15118 |
---|---|
Interpro abstract (IPR029367): | The function of small integral membrane protein 10 (SMIM10) is not clear. There are two conserved sequence motifs: FCK and RTL. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4560