The domain within your query sequence starts at position 18 and ends at position 132; the E-value for the DUF4562 domain shown below is 1.1e-59.

IVTGPDYVKDHLPKVHQHTAYIGEKRPALEKTGDLRYLWRPASNRSLPAKYKHEYTCGIG
WGIPQYSFFNRSRVESGFHIQHGELSLRAMDKITHRYQNPWQPKAFVLNKQLGYS

DUF4562

DUF4562
PFAM accession number:PF15123
Interpro abstract (IPR027814):

This family of proteins is found in eukaryotes and is functionally uncharacterised. Members of the family contain a conserved HRYQNPW sequence motif. This family includes the human protein C4orf45 ( Q96LM5 ).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4562