The domain within your query sequence starts at position 1 and ends at position 83; the E-value for the DUF4569 domain shown below is 3.1e-40.
MEPLEKTSTSKLFNGDEIREKSMLLHKQPLSNSMLNNYIERKVDELYKQFLEENLTRCLS ITNLMTSSILMNNVNQISLQISQ
DUF4569 |
---|
PFAM accession number: | PF15133 |
---|---|
Interpro abstract (IPR027869): | This family of proteins is found in eukaryotes and includes human protein CXorf21, which is thought to play a role in the regulation of endolysosomal pH in immune cells such as B-cells, dendritic cells and monocytes [ (PUBMED:31001245) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4569