The domain within your query sequence starts at position 1 and ends at position 90; the E-value for the DUF4576 domain shown below is 1.3e-50.
MAVSVLRLMVVLGLSALILTCRADDNPNENDNPDSKPDDSSKNPEPGFPKFLSILGSEII ENAVDFILRSMSRGSSFMELEGDPGQQPSK
DUF4576 |
---|
PFAM accession number: | PF15144 |
---|---|
Interpro abstract (IPR027950): | This family of uncharacterised proteins is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4576